PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn353131
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family BES1
Protein Properties Length: 285aa    MW: 30640.1 Da    PI: 7.4374
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn353131genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822214.23.1e-6661522150
      DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl.eeaeaagssasaspesslqsslk 99 
                 ++ r ptwkErEnnkrRERrRRaiaaki++GLR+qGn+klpk++DnneVlkALc+eAGwvvedDGttyrkg++p+ +++e+ g+ +++s +ss q s++
  Achn353131   6 STERLPTWKERENNKRRERRRRAIAAKIFTGLRSQGNFKLPKHCDNNEVLKALCAEAGWVVEDDGTTYRKGCRPPpTSTEIPGTIRNISACSSAQPSPT 104
                 7899***********************************************************************999********************* PP

      DUF822 100 ssalaspvesysaspksssfpspssldsislasaasllpvlsvlslvsssl 150
                 s++++spv+sy asp+sssfpsp+++d+++++    ++p+l +l++++ssl
  Achn353131 105 STSFPSPVPSYPASPTSSSFPSPTRFDQNPSS---YIIPLLCNLASIPSSL 152
                 *****************************985...8999998888888775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056873.7E-627132IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MTAGGSTERL PTWKERENNK RRERRRRAIA AKIFTGLRSQ GNFKLPKHCD NNEVLKALCA  60
EAGWVVEDDG TTYRKGCRPP PTSTEIPGTI RNISACSSAQ PSPTSTSFPS PVPSYPASPT  120
SSSFPSPTRF DQNPSSYIIP LLCNLASIPS SLPPLRISNS APITPPLSSP NSQASPTRHH  180
HVTPATIPEC DESDVSTVDS GRWVSFQTVT APASPTFNLV KPVAQQSSLQ EGHEELGWGS  240
MAQRGRGSEF EFESGTVKAW EGERIHEIGV DDLELTLGSG KGCA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009349751.11e-127PREDICTED: BES1/BZR1 homolog protein 2-like
SwissprotQ94A433e-95BEH2_ARATH; BES1/BZR1 homolog protein 2
TrEMBLM5VR331e-123M5VR33_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s12790.11e-121(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA94862128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.27e-62BES1 family protein